McDonnell Genome Institute

Washington University

CircRNA

chr1|220151605|220210489|-|RAB3GAP2|ENST00000358951.6

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9599

13

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

19

Peptide

AMNGVLLLAQLLNEDPVLQLK

Amino Acids from 5' Exons

AILQVHDKEVLASQLLVLTGQRLAHALLHTQTKEGMELLARLPPTLCTWLKAM,PFYRFMTKRSLPLSCWCSRGKGWLMRFSTPRQKKEWSCLPDFHPHCVLGKQ,HSTGSQRGPCLSAAGAHGAKAGSCASPHPDKRRNGAACQTSTHTVYLAESN

Amino Acids from 3' Exons

NGVLLLAQLLNEDPVLQLKCRTYEIPRHPGVTEQ,MVCSCLHSFMRTQYFNLNAEPMKYHDIPALS,WCALACTAFEGPSTSTMQNLNTTTSRRDA