McDonnell Genome Institute

Washington University

CircRNA

chr1|220062756|220074071|-|BPNT1|ENST00000322067.11

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9974

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

23

9

Peptide

LVTDCVAAMNPDAVLRVGGAGNKTCATDLQTK

Amino Acids from 5' Exons

AGPDAVLGRTIWGVLGLGAFGFQLKEVPAGKHIITTTRSHSNKLVTDCVAAMNPDAVLRVGGAGNK,QDQMLCWGGQSGEFVAPLGFSKKSLLGNTLSQLLDPIATSWLLTVLLLTPMLCCEEEQEI,RTRCCVGEDNLGSFRFRRLWVSAERSPCWETHYHNYSIPQQVGYLCCCYEPRCCAASRRSRK

Amino Acids from 3' Exons

TCATDLQTKADRLAQMSICSSLARKFPKLTIIGEE,PVQQTCRPKLTDWHRAYVLHWPGNSPNSQLGK,LCNRPADQSPIGTDEHMFFIGPEIPQTHNYRGR