McDonnell Genome Institute

Washington University

CircRNA

chr1|220001137|220020221|-|EPRS|ENST00000366923.7

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9992

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

23

Peptide

MSVYPTYDFACPIVDSIEGVTHALR

Amino Acids from 5' Exons

PILQGSPVCFDIHSWAHKGNANIRVKGKDQSRSHKK,PYSCKEAPCVLIYIPDGHTKEMPTSGSKEKTKVEATKNE,HIVARKPRVFYTFLMGTQRKCQHQGQRKRPKKPQKM

Amino Acids from 3' Exons

CLSNIFCLPHSQHRRCYTCPENNRIPQRAVLLDYSFRHKKTIYLGISAKSQQHSAIQKKTHMVCQRTSRWM,VYPTYDFACPIVDSIEGVTHALRTTEYHDRDEQFYWIIEALGIRKPYIWEYSRLNLNNTVLSKRKLTWFVNEGLVDG,FIQHMILPAPLTASKVLHMPEQQNTMTEMSSFTGLLKLAENHIFGNIVGISTTQCYPKENSHGLSMKDMD