McDonnell Genome Institute

Washington University

CircRNA

chr1|21814397|21816074|+|LDLRAD2|ENST00000344642.6

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9961

20

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

2

Peptide

ALGAGGSPR

Amino Acids from 5' Exons

PTWRNCAGRRGRGTGCCCARTPHRAGSTSWLRTPTAGSGCRRQPPATGSASSSASSWSTAPPRPRRSTPPPRPRPTRAPPAPTCSSTRARRGRPGPWGPHCAATSRCLWHPPDPFACAWSREAASPAWTSWAKSPLSVW,RPGGTVRADVAGGRAAAALARRIAQVLLRGSGHRLRALGAGGSPRRPDPLPVPLLPGLQPDPRAPGAQHLLPGPGRPVRPRLLPAVLRGPAGGAPAPGVPTVRPEHPGACGILRTLSRPAPGHERPPAPRGLRGRSHLFPS,DLAELCGQTWQGDGLLLRSHAASRRFYFVAPDTDCGLWVQAAAPGDRIRFQFRFFLVYSLTPAPPALNTSSPAPADPCAPGSYLQFYEGPPGAPRPLGSPLCGLNIPVPVASSGPFLGLRLVTRGRQPRVDFVGEVTSFRL

Amino Acids from 3' Exons

DLVVPTSAARMAGASPQASCVTPGAWTTVAMAVTRAPGHQLTAE,TLWCLLPLPEWQVHPLKPRVPLGHGQLWRWQPGLLVTSLQ,PCGAYFRCQNGRCIPSSLVCDPWGMDNCGDGSDQGSWSPADCR