McDonnell Genome Institute

Washington University

CircRNA

chr1|21729703|21736625|-|USP48|ENST00000374730.2

Cancer

Type of Peptide

CCRC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9886

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

11

Peptide

LQLGIEEDLGK

Amino Acids from 5' Exons

QNLLSLRHVNPSVAKELIALEMHICWFIDCKLKKSPTLLFKFQ,RTFVSDTTQVWQRNSLLSKCIYVGLTANSRKAQHYCSSS,EPSKSQTRKPKCGKGTHCSRNAYMLVYRLQTQEKPNTTVQVP

Amino Acids from 3' Exons

VGPTCMNSAQSSYTEEVLILATTSPTKIHSLVNGISLMMKTKRWRGRNYNGLRKIVKPLS,WVLRVTQRSPHTQRSECLFWPLHRPRERSTVWMVVRHRKDGGEEITTRDGRSRNLV,GSYVYELSAVLIHRGVSAYSGHYIAHVKDPQSGEWYKFNDEDIEKMEGKKLQLGIEEDLGKTFK