McDonnell Genome Institute

Washington University

CircRNA

chr1|21687190|21695221|-|USP48|ENST00000308271.13

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9736

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

14

2

Peptide

LMNQLQIMLQWMMSCK

Amino Acids from 5' Exons

ADEPIADYAAMDDVMQ,LMNQLQIMLQWMMSCK,TNCRLCCNGCHA

Amino Acids from 3' Exons

SNGGTKRQKISHQNYIAYQKQVIRRSMRHRKVRGEKALLVSANQTLKELKIQ,AMVEQSGKRYPIKIIPIKSKLFAEVCDIEKFVVRKHFSFLLIRRKNKF,QWWNKAAKDIPSKLYSLSKASYSPKYATKSSWESTSRFCSDVKRIENS