McDonnell Genome Institute

Washington University

CircRNA

chr1|21617305|21620050|-|RAP1GAP|ENST00000290101.8

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9687

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

10

Peptide

NTDLFEMIEK

Amino Acids from 5' Exons

VLGREGPFPLILLPQFGGYWIEGTNHEITSIPETEPLQSPTTKVKLECNPTARIYRKHFLGK,SWGEKDPSPSSCCPSLGATGLRAPTTKSPASPRQSHCSRPQPRSSSATPQPASTGSTFSA,LGARRTLPPHPAAPVWGLLDGHQPRNHQHPRDRATAVAHNQGEARVQPHSPHLPEALSRQ

Amino Acids from 3' Exons

NTDLFEMIEKMQ,TQIYLRLRRC,HRSIDDEDA