McDonnell Genome Institute

Washington University

CircRNA

chr1|216086718|216207431|-|USH2A|ENST00000307340.7

Cancer

Type of Peptide

PRAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9939

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

2

Peptide

EVIPSSGR

Amino Acids from 5' Exons

VPLPSMVVLLLEITQESFWEGSREVIPSSGRIL,FLCHPEWYCYWRHRSLSGRAPAKLYHPQEGS,SSAILNGSTVIGDNTGVFLGGLPRSYTILRKDP

Amino Acids from 3' Exons

LHSSNLRPEDKFKVLLLSISPGVHLILQMPTGLLTVYSGMVLKSTQQRINTHT,SIPATSAQRTSSKFFCYQSLLESTFSKCPLAYLQFTQGWFNLHNRGSIPI,PFQQPPPRGQVQSSSAINLSWSPPDSPNAHWLTYSLLRDGFEIYTTEDQYPY