McDonnell Genome Institute

Washington University

CircRNA

chr1|215586494|215595471|+|KCTD3|ENST00000259154.8

Cancer

Type of Peptide

BRCA-Luminal A

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9419

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

13

Peptide

MLSSLLVTSWWPR

Amino Acids from 5' Exons

NQRIFRMAASVYEPIFGLDYRTSSFKCKGGWRATWRQRQNGCCCLREHHLVECSGWGKWKN,IKESSGWQQVFTSPYLDWTIERVALNAKVVGGPHGDKDKMVAVASESSIILWSVQDGGSGSEI,SKNLQDGSKCLRAHIWIGLSNELMQRWLEGHMETKTKWLLLPQRVASSCGVFRMGEVEVKL

Amino Acids from 3' Exons

ECSAWVFLMLSSLLVTSWWPRVIQGKWECGMLSLSTG,SVQPGCSCRCSLLYWPVGGHESYRESGSVECCHSALA,VFSLGVPVDALFFIGNQLVATSHTGKVGVWNAVTQHWQ