McDonnell Genome Institute

Washington University

CircRNA

chr1|212072100|212080750|+|DTL|ENST00000366991.4

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9842

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

15

6

Peptide

ESRPGLVAIFNGHQNSTFYVK

Amino Acids from 5' Exons

WLFSMDTRTLPFMNPALVQMTSFSVAQVMKLPTYG,GYFQWTPELYLLCKIQPSRPVFSQWLKSCLHME,AIFNGHQNSTFYVKSSLSPDDQFLVSGSSDEAAYIWK

Amino Acids from 3' Exons

IATCSDDNTLKIWRLNRGLEEKPGGDKLSTVGWASQKKKESRPGL,LLPVLMTIHKSGAIEARRNQEVINFPRWVGPLRRKKSQDLA,CYLFQYTKNLALERLRGETRRTFHGGLGLSEEKRVKTWP