McDonnell Genome Institute

Washington University

CircRNA

chr1|209789666|209790887|-|IRF6|ENST00000367021.7

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9908

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

6

Peptide

ETHLGSVTDLDIK

Amino Acids from 5' Exons

ISLPTRKDRRSSHRLRSTYALGKNGQMGNHWKGNSSWF,SHCPPERTDREAATVDLLMLWGRMARWETIGKETHLGS,LIAHQKGQIEKQPPFEIYLCFGEEWPDGKPLERKLILVQ

Amino Acids from 3' Exons

LTWTSSFSTVGRSTGRPPATLRAADSSMGTWVPCLTRRSSLVPSAWSRSNSQVLSILPMRSRSCSLASCWTSWTEDSWRSAVMPFMPSGCASARCTGLGHVPHHLLLPTLRDKRRSSYFVWKHSLA,DPGHQVSVPWEGVRADHDREQPSGLPTLLWGPGSHAPGGALWSRQPGAGQIPRSAYYQEAEAVHQAAGRHGQRTDPGGQRSCHLCHQAVPVQGVLVWAMCPITCCSQPDETKEGQAILSGNIP,TDLDIKFQYRGKEYGQTMTVSNPQGCRLFYGDLGPMPDQEELFGPVSLEQVKFPGPEHITNEKQKLFTSKLLDVMDRGLILEVSGHAIYAIRLCQCKVYWSGPCAPSLVAPNLIERQKKVKLFCLETFLS