McDonnell Genome Institute

Washington University

CircRNA

chr1|209625647|209626026|-|LAMB3|ENST00000356082.8

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9966

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

23

Peptide

AVLSSPAVTEQEVAQVASAILSLSL

Amino Acids from 5' Exons

PVTVISGEQRARAATRHQAAASAALAPGPAVTSASEATVIATRCAWPATLASRPMMRTSGSRPCALVDSAMPPPACGQGLGWRTVAWPPGSMQRVRLSRSEQFSAAPQSQSRRWLRWPVPSSPS,LLFPGNRGPGLRQGIRPLPLPPWLDRAPLPVPARLLSLPGVRGLPPLLPDLCGPPGAGPALWTPQCHRQPVVRAWAGGPWPGLPDPRCKEDADPSSSQQPRSHRAGGGSGGQCHPLPQ,CDCDFRGTEGPGCDKASGRCLCRPGLTGPRCDQCQRGYCNRYPVCVACHPCFQTYDADLREQALRFGRLRNATASLWSGPGLEDRGLASRILDAKSKIEQIRAVLSSPAVTEQEVAQVASAILSL

Amino Acids from 3' Exons

PVTVISGEQRARAATRHQAAASAALAPGPAVTSASEATVIATRCAWPATLASRPMMRTSGSRPCALVDSAMPPPACGQGLGWRTVAWPPGSMQRVRLSRSEQFSAAPQSQSRRWLRWPVPSSPS,LLFPGNRGPGLRQGIRPLPLPPWLDRAPLPVPARLLSLPGVRGLPPLLPDLCGPPGAGPALWTPQCHRQPVVRAWAGGPWPGLPDPRCKEDADPSSSQQPRSHRAGGGSGGQCHPLPQ,CDCDFRGTEGPGCDKASGRCLCRPGLTGPRCDQCQRGYCNRYPVCVACHPCFQTYDADLREQALRFGRLRNATASLWSGPGLEDRGLASRILDAKSKIEQIRAVLSSPAVTEQEVAQVASAILSL