McDonnell Genome Institute

Washington University

CircRNA

chr1|207697502|207701618|+|CR1L|ENST00000294997.10

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9733

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

13

12

Peptide

MLDPESTILVLQVCQPPPDVLHAER

Amino Acids from 5' Exons

YVSHLQMSCMLSVPKGTRTTFHPGRKCSTAVSPATTSEDLRICTAHPRETGALQPPDVK,MSATSRCPACAYPKGQGQLFTRAGSVLQLARLRPQRIYVFALHTPGRLEPCSPQM,CQPPPDVLHAERTQRDKDNFSPGQEVFYSCEPGYDLRGSTYLHCTPQGDWSPAAPRCE

Amino Acids from 3' Exons

VNHVKLLQFQMAWCMSQTSMLDPESTILVLQ,IMNSSSSSEWHGACDHRHPCWIQNQLFLYYR,KSCETPPVPVNGMVHVITDIHVGSRINYSCTT