McDonnell Genome Institute

Washington University

CircRNA

chr1|207067498|207068309|+|PFKFB2|ENST00000367079.3

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9953

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

7

Peptide

ILNEIDAGSFFHQGDKR

Amino Acids from 5' Exons

GSFFHQGDKRGPAIFSQQSPGLHPEQDSLLPHEYPRPASHHLPLPAWRKRVQSLGEDWGLWPLGAGKA,DLSFIKVINVGQRFLVNRVQDYIQSKIVYYLMNIHVQPRTIYLCRHGESEFNLLGKIGGDSGLSVRGKQ,IFLSSRTWASDFSTESRTTSRARSTTSISTSSLAPFTFAGMEKASSISWGRLGVTLASRCGES,GSFFHQGDKRGPAIFSQQSPGLHPEQDSLLPHEYPRPASHHLPLPAWRKRVQSLGEDWGLWPLGAGKA,DLSFIKVINVGQRFLVNRVQDYIQSKIVYYLMNIHVQPRTIYLCRHGESEFNLLGKIGGDSGLSVRGKQ,IFLSSRTWASDFSTESRTTSRARSTTSISTSSLAPFTFAGMEKASSISWGRLGVTLASRCGES

Amino Acids from 3' Exons

FAQALRKFLEEQEITDLKVWTSQLKRTIQTAESLGVPYEQWKILNEIDA,LPKLGNFWRNRKQTSKCGQASRGPYRLLNLSGCPMSSGRFMRLM,CPSSKEISGGTGNNRPQSVDKPVEEDHTDCISRGALAVEDSEDC,FAQALRKFLEEQEITDLKVWTSQLKRTIQTAESLGVPYEQWKILNEIDA,LPKLGNFWRNRKQTSKCGQASRGPYRLLNLSGCPMSSGRFMRLM,CPSSKEISGGTGNNRPQSVDKPVEEDHTDCISRGALAVEDSEDC