McDonnell Genome Institute

Washington University

CircRNA

chr1|20704446|20709828|-|KIF17|ENST00000247986.2

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9508

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

11

Peptide

EGAVHAHGAQR

Amino Acids from 5' Exons

MSGARTTSGRASTWWTWRAASGSPRPGPRASGSRRPPRSTCRSRHWAMSSRRWWTGAVSTSPTVTRSRGCCRTHWAATPRRSWWPACRLRTTTTMRHSARCATPTGPRTSGTSRASMRTPRMRCFASTRRRSRSSRPSHSRAPAACQ,AGQGPPPGGQAEPGGPGGQRAAVQDRGHGRAAQGGHQDQPVALGTGQCHLGAGGRALARPLPLEADAAAAGLTGRQHQDAHGGLPVACGQQLRDTQHAALRQPGQEHQEQAAHQGPQGCAASRVPGGDQEAQGHPDTADEPQQPV,ERGKDHLRAGKLNLVDLAGSERQSKTGATGERLKEATKINLSLSALGNVISALVDGRCKHVPYRDSKLTRLLQDSLGGNTKTLMVACLSPADNNYDETLSTLRYANRAKNIRNKPRINEDPKDALLREYQEEIKKLKAILTQQMSPSSLS

Amino Acids from 3' Exons

LKEHPEKGVYVKGLSMHTVHSVAQCEHIMETGWKNRSVGYTLMNKDSSRSHSIFTISIEMSAV,RSTQRRACTRGCPCTRCTAWPSVSTSWRLAGRTVRSATRTRIPHARTPSSPSASRCLPW,EGAPREGRVREGAVHAHGAQRGPVAHHGDWLEEPFGRLHADEQGFLTLALHLHHQHRDVCR