McDonnell Genome Institute

Washington University

CircRNA

chr1|206392688|206438098|+|SRGAP2|ENST00000573034.7

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9171

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

1

Peptide

QHQCSEQTK

Amino Acids from 5' Exons

VMKTYHMYNADSISAQSKLKEAEKQEEKQIGKSVKQEDRQTPRSPDSTANVRIEEKHVRRSSVKKIEKMKEK,RHITCTMPTASVLRANRRRRSRRRSKLVNRSRRTGRPHAPLTPRPTFALRRNMSGGAQRRLRRRR,DEDISHVQCRQHQCSEQTKGGGEAGGEANWIGKAGGPADPTLPLHGQRSHGETCPEELSEEDEDEGE

Amino Acids from 3' Exons

ERTPWLGTRTTMTWIPLVSSFTSGGWNTLSSPRTSFMTWPAS,RGPPGWGPERPHGFHSWCPEALLPGAGTPSLPQGHLSPDGLR,EDPLAGDQNDHDMDSIAGVLKLYFRGLEHPLFPKDIFHDLMACV