McDonnell Genome Institute

Washington University

CircRNA

chr1|206303280|206303473|+|SRGAP2|ENST00000572793.2

Cancer

Type of Peptide

BRCA-HER2-enriched

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9145

9

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

9

Peptide

SWQNASWPR

Amino Acids from 5' Exons

RSVLSSQSRNAWTSSVSFGCNCCRTSRTSSERRQRLRWTTPATWRSWQNASWPRHAAPRTSNS,DPCSAHRADEMPGPAVASGATVAGPPGLLPKEGRDDGLLPQPGEAGRTLPGQDTQHQGPAIQ,IRAQLTEQMKCLDQQCELRVQLLQDLQDFFRKKAEIEMDYSRNLEKLAERFLAKTRSTKDQQF

Amino Acids from 3' Exons

RSVLSSQSRNAWTSSVSFGCNCCRTSRTSSERRQRLRWTTPATWRSWQNASWPRHAAPRTSNS,DPCSAHRADEMPGPAVASGATVAGPPGLLPKEGRDDGLLPQPGEAGRTLPGQDTQHQGPAIQ,IRAQLTEQMKCLDQQCELRVQLLQDLQDFFRKKAEIEMDYSRNLEKLAERFLAKTRSTKDQQF