McDonnell Genome Institute

Washington University

CircRNA

chr1|205524231|205524357|+|CDK18|ENST00000360066.6

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9999

14

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

4

Peptide

ASLDVSK

Amino Acids from 5' Exons

DVSKRLSLPMDIRLPQEFLQKLQMESPDLPKPLSRMSRRASL,TSARGSLCPWISACPRNSYRSYRWRAQICPSRSAACPAGPP,RQQEALSAHGYPPAPGIPTEATDGEPRSAQAAQPHVPPGLP

Amino Acids from 3' Exons

DVSKRLSLPMDIRLPQEFLQKLQMESPDLPKPLSRMSRRASL,TSARGSLCPWISACPRNSYRSYRWRAQICPSRSAACPAGPP,RQQEALSAHGYPPAPGIPTEATDGEPRSAQAAQPHVPPGLP