McDonnell Genome Institute

Washington University

CircRNA

chr1|204248820|204261508|-|PLEKHA6|ENST00000414478.1

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

12

Peptide

CLSPQAEHAGVR

Amino Acids from 5' Exons

ESLESALMGTHQELEMFGSQPAYPEKLRHKKDSLQNQLINIRVELSQATT,RAWKVPWGPTRSWRCLEASPPTQKSCDTKRIHCRTSSSTSAWSCLRRP,EPGKCLDGDPPGAGDVWKPARLPRKAATQKGFTAEPAHQHPRGAVSGDH

Amino Acids from 3' Exons

VTVCWVDEAEASSTRCLSPQAEHAGVRTYFFSAESPEEQEAWIQAMGEAARVQIPPAQKSVPQAVRH,LCAGWMRPRPAPHAASPHRLSMPGSAPTSSVPRAPRSKRPGSRPWGRLLEYRSLQPRSQCPKLCGT,DCVLGGGRGQLHTLPLPTGACRGPHLLLQCREPRGARGLDPGHGGGCSSTDPSSPEVSAPSCAAQ