McDonnell Genome Institute

Washington University

CircRNA

chr1|203727394|203733400|+|ATP2B4|ENST00000341360.6

Cancer

Type of Peptide

PRAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

26

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

14

Peptide

LVPSSSYVAVAPVK

Amino Acids from 5' Exons

FISAIPTRSLKFLKEAGHGTTKEEITKDAEGLDEIDHAEMELRRGQILWFRGLNRIQTQ,SSPQYLPDPSSRRLGMAPPKRRSPRMPRDWMRLTMLRWSCAEARSSGSGATVSRL,HLRNTYPIPEVPEGGWAWHHQRGDHQGCRGTGDPCDGAAPRPDPLVPGPEPYPDS

Amino Acids from 3' Exons

IDVINTFQTGASFKGVLRRQNMGQHLDVKLVPSSSYVAVAPVKSSPTTSVPAVSSPPMG,STLTHSRREPLLRESGDRTWVNTLMNLFLVHPMQLHQSNLPPPLLFLLFHLLLWA,RRNHIPDGSLFGSPKATEHGSTPCKTCSFILCSSCTSQIFPHHFCSCCFISSYG