McDonnell Genome Institute

Washington University

CircRNA

chr1|203709300|203722689|+|ATP2B4|ENST00000341360.6

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9644

37

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

15

Peptide

NIIFCSVVLGTFICQPPEK

Amino Acids from 5' Exons

PPEKEGGLPRQVGNKTECALLGFVTDLKQDYQAVRNEVPEEKLYKVYTFNSVRKSMSTVIRNPNGGFRMYSKGASEIILR,LQRRREACLGRWATRPSVLCALSQISRIIRLCVMKCPRRSSTRCTPLTQCASQAPSSGIPTVASVCTARAPLRSSCA,SREGGRPASAGGQQDRVCSARLCHRSEAGLSGCASARGEALQGVHLLSAQVNEHRHQESQRWLPYVQQGRLDHLAQ

Amino Acids from 3' Exons

VRNSLILIVGGRHLYIHHPASTIPLFLTPSCCSSSMKSTPERSMERRTSFQASTATLSSALSWAHSSA,EILYWEEGTSTFTTQPALYHCFHLRADAALQNQLPKDPWREERLFRHLPQHYLLLCSLGHIHLP,EKFFDIDSGRKAPLHSPPSQHYTIVFNTFVLMQLFNEINSRKIHGEKNVFSGIYRNIIFCSVVLGTFICQ