McDonnell Genome Institute

Washington University

CircRNA

chr1|203703651|203721410|+|ATP2B4|ENST00000341360.6

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9562

44

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

19

Peptide

NILGHAFYQLIVIFILVFAAK

Amino Acids from 5' Exons

QRPKTEWPWKSSHSTARRESTMRKRTRRQSRCLKRRSQCCRASLAWLFRLGKP,KDPRRSGPGNPATQQPGGNRQGKGQEGSQGAKGEVSAAGQADSPGCSDWES,KTQDGVALEIQPLNSQEGIDNEEKDKKAVKVPKKEKSVLQGKLTRLAVQIGKA

Amino Acids from 3' Exons

DSPLKAVQMLWVNLIMDTFASLALATEPPTESLLKRRPYGRNKPLISRTMMKNILGHAFYQLIVIFILVFA,IPHKLCRCCGLISWTLLLHWPWPQSPLRNLCSGAPMAEISLSHALRTSWAMHSISSLSSLSLSLR,FPIESCADVVGSDHGHFCFIGPGHRAPYGISVEAAPLWPKASDLTHYDEEHLGPCILSAHCHLYPCLC