McDonnell Genome Institute

Washington University

CircRNA

chr1|202963641|202965500|-|CYB5R1|ENST00000367249.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9672

10

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

15

9

Peptide

VPEDPTQCFLLFANQVYLKGVHPK

Amino Acids from 5' Exons

ESPQCYSSGPSKSLKIQPSAFCFLPT,NHPNATADPGHPESPRSNPVLSAFCQP,ITPMLQLIRAILKVPEDPTQCFLLFANQ

Amino Acids from 3' Exons

VYLKGVHPKFPEGGKMSQYLDSLKVGDVVEFRGPSGLLTYTGK,STRVCTPNFLREGRCLSTWIARLGMWWSFGGQAGCSLTLEK,LPEGCAPQISGREDVSVPGPEGWGCGGVSGAKRVAHLHWK