McDonnell Genome Institute

Washington University

CircRNA

chr1|202946438|202951164|-|ADIPOR1|ENST00000340990.9

Cancer

Type of Peptide

OSCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9922

79

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

9

Peptide

LQGIEVPAR

Amino Acids from 5' Exons

VWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLL,SGRDVGGSSHMMCSLTGRTTTICYMVIDLPCPPFGLASRASSAFIQKLATSGPICL,LGGTLEGHPICAPLAKGQRLSATWSTSHALLSGLLQEHLPHSYRNWQHLDPSA

Amino Acids from 3' Exons

CLPSEGDLCPLGLRDPNLSPSSCRVLRYQPDVFPQRICGGTGEWGSCQQGSHGGTGTGTPARREGQTGNRQPTQ,VYHQREISAPWGETPTFPQAEAAGYGTSQMSSHKGSVVAQGNGAPASNREADTVELAELGPLLEEKGKRVIANPPK,STIRGRSLPPGAERPQPFPKLKLQGIEVPARCLPTKDLWWHRGMGLLPVTGKLTRWNWLNWDPCKRRANGSPTHP