McDonnell Genome Institute

Washington University

CircRNA

chr1|202893238|202895717|-|KLHL12|ENST00000367261.7

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9845

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

5

Peptide

LYAIAGASLVR

Amino Acids from 5' Exons

VQEPCMTIFMWWGDLMVQPTFLPLKHTTFALIPGQLSPVPLHDAMGPQCFGGDSMQLQ,CRSSPAEPYLCGGGIWYSPPFFRSIQHSHFLDNCHQYDHSTMLCRGHSASGETLCNCR,AGVALLNDHIYVVGGFDGTAHLSSVEAYNIRTDSWTTVTSMTTPRCYVGATVLRGRLYAIA

Amino Acids from 3' Exons

SITRKRRYVASVSLHDRIYVIGGYDGRSRLSSVECLDYTADEDGVWYSVAPMNVRRGLAGATTLG,ASLVRDVMWPQCPFMTGSTSLVAMMAVPALVQWNVTTQQMRMGSGILWPLMSDEVLLEPPPWE,HHSETLCGLSVPSPDLRHWWLWPFPPFSGMSRLHSRGWGLVFCGPYECPTRSCWSHHPG