McDonnell Genome Institute

Washington University

CircRNA

chr1|202760414|202773288|-|KDM5B|ENST00000235790.8

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9842

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

13

Peptide

CLAQLVAEEGGFAVVCK

Amino Acids from 5' Exons

VDLYVCLLCGSGNDEDRLLLCDGCDDSYHTFCLIPPLHDVPKGDWRCPKCLAQ,WTCMSVFYVAVAMMKTGYCCVMAVMTVTIPFASHLSMMFPRETGGVLSVWL,GPVCLSFMWQWQRPATVVWLQLPYLLLDPTSPCSQGRLEVSVFGS

Amino Acids from 3' Exons

LVAEEGGFAVVCKDRKWTKIATKMGFAPGKAVGSHIRGHYERILNPYNLFLSGDSLR,LQKKVDLQLFARIENGPKLLPRWGLLLAKQWAHISEGIMNEFSTPTTYSCPETA,SCRRRWICSCLQGKMDQNCYQDGVCSWQSSGLTYQRALTNSQPLQLIPVRRQPK