McDonnell Genome Institute

Washington University

CircRNA

chr1|201648633|201718755|+|NAV1|ENST00000367302.5

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9677

9

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

3

Peptide

RQEGGSGGRQR

Amino Acids from 5' Exons

TRGSSMRSSRAECWAAASRACSPRWSAAAAATRARTNRGAPAGRRQRRTAEACCPSAPRRPAAAAAWPRPARLSRSSSPAAWTAVSPAGRPPPTCASRSHSPTSLFSRTPRKSCSFMSPNGATIWPRRPKAARWGPRAVKLRCPRRCPSRSTRSSRPRAARRAAPRPPWLRSRPTWESRAGSLEDPMRRSSRSARRLKRPAKMANRTTSCSPARPRRKRALGLSPLPRARRSAPSSRWTPSWWPCWETWSSCSSARCW,RADRPCAPRGQNAGQQRQERAARGGAEQRRRRRGRGRTAGRRQEGGSGGRQRHAAQARQGARRRRRHGQGQRGAEGLQVRQRGQPCPRRAARLQPAQAEVTHQPLFSHGLREKAAALARMERRYGQGAQRLRQGGVQGPSSADVQDAVQVGALALPGQGQPGGRRQDPPGSARAQPGKAEPDPSRTLCGGQAAQQGASGRERRWQIGRRAALQQGQGAKELWACPLCQGPGGARLPQGGPRAGGDRAGRPGAAALQPDA,ARIVHALLAGRMLGSSVKSVQPEVELSSGGGDEGADEPRGAGRKAAAADGRGMLPKRAKAPGGGGGMAKASAAELKVFKSGSVDSRVPGGPPASNLRKQKSLTNLSFLTDSEKKLQLYEPEWSDDMAKAPKGLGKVGSKGREAPLMSKTLSKSEHSLFQAKGSPAGGAKTPLAPLAPNLGKPSRIPRGPYAEVKPLSKAPEAAVSEDGKSDDELLSSKAKAQKSSGPVPSAKGQEERAFLKVDPELVVTVLGDLEQLLFSQML

Amino Acids from 3' Exons

LPGDDLLRQRCQPTQRVQPLQPLVPSVMALWPVQSAAAGWRALCGWELPLGGDARLVHARRTGPLLPHHAHAQPQQAQPYLPPGAGRIPGLGGGPQVRLHERQPHGQDHDGGHHYR,SLEMTCYDSDDANPRSVSSLSNRSSPLSWRYGQSSPRLQAGDAPSVGGSCRSEGTPAWYMHGERAHYSHTMPMRSPSKLSHISRLELVESLDSDEVDLKSGYMSDSDLMGKTMTEDDDITT,PWRPATTAMMPTHAACPASPTARPLCHGAMASPVRGCRLVTRPLWVGAAARRGRPPGTCTANGPTTPTPCPCAAPASSAISPAWSWSNPWTRMRWTSSPATATVTSWARPRRMMTSLP