McDonnell Genome Institute

Washington University

CircRNA

chr1|200605863|200615609|-|KIF14|ENST00000367350.4

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9096

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

2

Peptide

LSVLTLISREK

Amino Acids from 5' Exons

EHCQFLRYP,NIVSSYADIQ,TLSVLTLIS

Amino Acids from 3' Exons

REDKSIPGSLHEWERNNCGTPHETSLFYLCFILVFMSSSLRPDNCLEASSTTPRKSLRRLQYLSFCLWSDWLWKIIY,EKIEKASQVVFMSGKEITVEHPDTKQVYNFIYDVSFWSFDECHPHYASQTTVYEKLAAPLLERAFEGFNTCLFAYGQTGSGKSY,RRLKKHPRSSVGKKLWNTLTRNKFIILFMMFHSGLLMNVILTTLARQLSMRSQHHSKEPSKASIPVFLLMVRLALENHI