McDonnell Genome Institute

Washington University

CircRNA

chr1|200569910|200600503|-|KIF14|ENST00000367350.4

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9959

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

2

Peptide

NLHSSHSSELK

Amino Acids from 5' Exons

EEFDEEQKNFWLFTHTSPSNEFAFFTFI,SRSLMKNRRISGCLHDIQVHPIKNLHSSHSS,VGVRTEEFLVVYMTYKSIQLRICILHIHQ

Amino Acids from 3' Exons

NRQKLQSKLLRETVGILTLNDTGSVGKKHPENCINRRETWQKCK,IEGRNCKAKSCSEKQSEYPTIQALSARNNILKNETASTGERHGRNAK,LKAEIAKLKAAQRNSRNIDPERYRLCRQEITSLRMKLHQQERDMAEMQ