McDonnell Genome Institute

Washington University

CircRNA

chr1|197095997|197105185|-|ASPM|ENST00000367409.8

Cancer

Type of Peptide

BRCA-Luminal B

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9944

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

4

Peptide

LLLYQTR

Amino Acids from 5' Exons

AMWRRYRAKKYLCKVKAACKIQAWYRCWRAHKEYLAILKAVKIIQGCFYTKLERT,LCGGDIEPRNIYVKKLPARFKPGIDVGEHTKNILYKLLKLFKVASIPNREH,YVEEISQEIFMSESCLQDSSLVMLESTQRISSYIKSCNYSRLLLYQTRENT

Amino Acids from 3' Exons

GYWRRYSTRQRFLKLKYYSIILQSRIRMIIAVTSYKRYLWATVTIQRHWRAYLRRKQDQQRYEMLKSSTLIIQSMFRKWKQRKMQSQVKATVILQRAFREWHLRKQAKEENSAIIIQSWYRMHKELRKYIYIRSCVVIIQKRFRCFQAQKLYKRRKESILTIQKYYKAYLKGKIERTNYLQKRAAAIQLQAAFRRLKAHNLCRQIRAACVIQSYWRMRQDRVRFLNLKKTIIKFQAHVRKHQQRQKYKKMKKAAVIIQTHFRAYIFAMKVLASYQKTRSAVIVLQSAYRGMQARKMYIHILTSVIKIQSYYRAYVSKKEFLSLKNATIKLQSTVKMKQTRKQYLHLRAAALFIQQCYRSKKIAAQKREEYMQMRESCIKLQAFVRGYLVRKQMRLQRKAVISLQSYFRMRKARQYYLKMYKAIIVIQNYYHAYKAQVNQRKNFLQVKKAATCLQAAYRGYKVRQLIKQQSIAALKIQSAFRGYNKRVKYQSVLQSIIKIQRWYRAYKTLHDTRTHFLKTKAAVISLQSAYRGWKVRKQIRREHQAALKIQSAFRMAKAQKQFRLFKTAALVIQQNFRAWTAGRKQCMEYIELRHAVLVLQSMWKGKTLRRQLQRQHKCAIIIQSYYRMHVQQKKWKIMKKAALLIQKYYRAYSIGREQNHLYLKTKAAVVTLQSAYRGMKVRKRIKDCNKAAVTIQSKYRAYKTKKKYATYRASAIIIQRWYRGIKITNHQHKEYLNLKKTAIKIQSVYRGIRVRRHIQHMHRAATFIKAMFKMHQSRISYHTMRKAAIVIQVRCRAYYQGKMQREKYLTILKAVKVLQASFRGVRVRRTLRKMQTAATLIQSNYRRYRQQTYFNKLKKITKTVQQRYWAMKERNIQFQRYNKLRHSVIYIQAIFRGKKARRHLKMMHIAATLIQRRFRTLMMRRRFLSLKKTAILIQRKYRAHLCTKHHLQFLQVQNAVIKIQSSYRRWMIRKRMREMHRAATFIQSTFRMHRLHMRYQALKQASVVIQQQYQANRAAKLQRQHYLRQRHSAVILQAAFRGMKTRRHLKSMHSSATLIQSRFRSLLVRRRFISLKKATIFVQRKYRATICAKHKLYQFLHLRKAAITIQSSYRRLMVKKKLQEMQRAAVLIQATFRMYRTYITFQTWKHASILIQQHYRTYRAAKLQRENYIRQWHSAVVIQAAYKGMKARQLLREKHKASIVIQSTYRMYRQYCFYQKLQWATKIIQEKYRANKKKQKVFQHNELKKETCVQAGFQDMNIKKQIQEQHQAAIIIQKHCKAFKIRKHYLHLRATVVSIQRRYRKLTAVRTQAVICIQSYYRGFKVRKDIQNMHRAATLIQSFYRMHRAKVDYETKKTAIVVIQNYYRLYVRVKTERKNFLAVQKSVRTIQAAFRGMKVRQKLKNVSEEKMAAIVNQSALCCYRSKTQYEAVQSEGVMIQEWYKASGLACSQEAEYHSQSRAAVTIQKAFCRMVTRKLETQKCAALRIQFFLQMAVYRRRFVQQKRAAITLQHYFRTWQTRKQFLLYRKAAVVLQNHYRAFLSAKHQRQVYLQIRSSVIIIQARSKGFIQKRKFQEIKNSTIKIQ,DIGEDIPLDKDFNNIIQSSCNLGELLLHLINDIFGLQLQFRGIGVLIEENKINKDMKCNHQLLSNLCSENGSNVKCNHKKLQYCKELLENGIENKLKKKILLLSYNHGIECIKNYGNIFILDLVLLSFRKDFGAFKPKSYIKEEKSPYPSRSTTKHIKERLSAPTICRNELQPFNYKLLLGDKLIIYVDKLELLVLFSHTGEDKTEFDFTLRRLLSNFRHMENINNDRNIRRRKQLLFRLISELIFLPKFHLTRKHALLSLCCSLHIEGCKPGKCIFTSSHLLRFNHIIVLMFLKRNFAKMLQNCSQLLRNKHVNNICIEQLHYLSSNVTVPKKLHKREKSICRCGNLVSNCKHLLEDTLSESRGYKEKLLFHYSLISEERLGSIIKCIKQLLSFRITIMHTKHRSIRGRTSCKSKKQLLACKQLTEVIKYASSNNNLLLLKFSLLLEAIIKGNINLCFNLRFRDGTGRTRLFMIQEHIFRQRQLFPSSLLIVAGRFGNRLEGNIKLPRFSLLLEWPRPRNSLDCLKQQHSSSKISEHGLQEGSNVWSILNSVMRYWCFNLCGREKHEDSFKGNINVLSSYSHTIECMCNKRSGKSKKLLFFKSIIGLTVLEENRIIYIKQKQLLYSQLIVVKEKERIATKQQSLYSLNTELTKPKRNMQPIELQLLFRDGIEVLKLQTISIRSILIRRQQLKSNLFIEVLELEDIFNTCTGQPLLLKPCLKCISQEVTIQEKQLLLFKDVEHIIKVKCSVKSTQFKLLKSFRQVLEEELDGLLERCRLQQHSFSQTTEDTDSKHTLISRKQKQYSKDTGQKKETYNFKGITNGILYTFRLFLGERKLEDIKCIPQLSFRGDLELEEDSSLSRKLLFFRENIGHIFVQSITYSSFRYKMQLLKSSHHTEDGGKGCERCTGLLLSSSLLSECTDYIDIRLNRPPLSNSNTKQIELQNCRGSIISDKDTLLSFRLHSGVKLEDIRVCIPLQPLFRVGLDHYWGEDSFPSKKLLFLFRGNIEPPFVPNINCTNSCTERQPLQYSHLTEDWRRSYKKCKGLQFSFRLLSGCTEHILHFRLGNMLQFFSNIIEHIELQNYKEKIISDNGILLWLFRLHIKEKQDNFGKNTKLLSYKAPTECIGSIVSTKSFSGLQKSYKKNIEQIKRNRKYFNTMNLRKRLVFRQVFRTTKNRFRNSTRLPLLFRSIVKPLKGSIISTLEQQFLFKEDTENLQCVPKQLFVYSLITEALKYERIFKICTGLPHFSHSIECTGPKLIMKQRKLQLWLYRIIIGCMLEKQKEKTFQFRNLYELFRLLLEAKLDKNKMYQRKRWQPLLTNLHSAVTEVKLSMKLFKVKVLFKSGIKLLALLVHRKQSIILKVGLQQFKKLFVEWSQENWKHRNVLPYGFSSSFRWLCIGEDLFSRKELLSLYSIILGRGKPENSFYYIEKQQWFYKITTEHFCLQNIKDKSIYRSEAVLSLFKLEVKDLYRNGSFRKLKIAPKF,ILEKIFHTKISEIEILFNHPAIDKNDNCCYILTISLGYSYNSEALACLFKKKTRSTKINAKIINSYNPIYVQKMEATNAITSKSYSNIAKSFRMAFKKTSRRKFCYYHTIMVNARITEIYLYILCCYHSEKISVLSSPKVIKKKRVHTNHPEVLQSISERKDAHQLFAETSCSHSITSCFETESSFMTNSCLCYSVILENETRQSSIFKPEDYYQISGTCKKTSTTTEIEDEESSCYNSDSFPSLYFCHESSSILPENTLCCHCAAVCIRDASQENVYSHPHICYKDSIILSCLCFKGIFEPKKCYNKIAVNCDETNTTIFAFKSSCTIYPAMLPFQKNSCTKERRVYADAGILYQTASICRIPCPKADEVTKKSCYFTTVLFQNEKGSAVLSENVSNYCHSELLSCIQSTGQSEEELLASQKSSYLLASSLQRLSTPANQTTIYSCSNSVCFRLKGKISICASIYNKDSEMVQGVQDSSYKNTFFEDKGSCDFPPVCLSWLEGSETDKGTSSCLEDSVCFNGQGPETVIVNSSISHPAKFQSMDCRKEAMYGVYTPSCGTGASIYVEGKNTEKTASKATMCYHHTVILNACATKEVENHEKSCSSDSKVLGLQYWKRTESFIFENKSSCSNFTVSLSWYESEKKNKGLQQSSSHYTVIQSLQNQKEICNLSFSYYNSEMVSRYNYKPSAGVSFEEDSNNPICLRYSKTYSTHAQGSHFYSHVNASVKNKLPYNEKSSYCYSSKMSILSRNAAKVPDNFESCSPSGKFRSKSTDSKDADCSNTHSVKLQKIQTANILVKENNKNSTAKILGNERKKHTISKVQTEAFCNIHSGYFGKESKTFKNDAYSRNSHSEEINSNDEKKIPLSQENCYFDSEKISGTSLYKASLTVPSGTKCSYNPVIIQKMDDKEKDARDAQGCYFHPVYFQNAQITYEISGFETGLRCDPTAIPSKSCKTAEAALSQTKTLCCDPSGCIQGYENKTFEEYAFLCNPYSEVIITGEEKIHFPQKSYYFCSEEISSHHLCQTIVPILALKKGSHYNTVILQKTDGKEEVTRNAKGCSSHSGYFQDVQNIYYISDLETCFNSNSATLSNISCKITKRKLYQTMAFCCGYSGCIRNESKTTFKGKTQSFYRNTKHLQNVAVLFLPKASVGYKNHTRKISKKETESISTQTERDLCSGRFSGHEHKKTDSGTAPGCHYYSEALSLNKEALSPPSNSSFYSKKIQKTNCSAYPSSYLYTVLLQRLSTKGYSKYAPGCHTNSVILSNAQGQSLNKENCNCGYTELLVVCSKNRKKKLFSSSEICTNYSGCFRHESTKIEKCIRGKDGSHCPICTLLLQKNSVSCSKRCYDSRVVSFWPCLFTGSRVSFSKGCSNNSKSFLNGHKKTGNTEMCCPTDSVLPSDGCVSEKICSAEKSCYHFTALFDVANQKTVFTIKSSSGFTKSLQSISVCKTSKTSLFTDQKQCYHYSSKRIYTETEVSGNKHHKNS