McDonnell Genome Institute

Washington University

CircRNA

chr1|19694433|19694551|-|TMCO4|ENST00000294543.10

Cancer

Type of Peptide

BRCA-HER2-enriched

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9671

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

9

Peptide

VENVDLTSVGR

Amino Acids from 5' Exons

GRLAAEFRVPHILGAAPCRRPTARAAAGQEGGERGPDLC,GDWLLSFVYRTSSVQLRVAGLQPVLLQDRRVENVDLTSV,ETGCVSCTAHPRCSSVSPAYSPCCCRTGGWRTWTPL

Amino Acids from 3' Exons

GRLAAEFRVPHILGAAPCRRPTARAAAGQEGGERGPDLC,GDWLLSFVYRTSSVQLRVAGLQPVLLQDRRVENVDLTSV,ETGCVSCTAHPRCSSVSPAYSPCCCRTGGWRTWTPL