McDonnell Genome Institute

Washington University

CircRNA

chr1|19105047|19169532|-|UBR4|ENST00000375254.7

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.922

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

19

Peptide

LCVSPGTTSIPMNFPILDP

Amino Acids from 5' Exons

LPGAEHSWGVCSVPGSLPEAHHFCALESLLGSSGSPTLCGQPHHQ,YLDELSIAGECAAEYLALYQKLITSAHWKVYLAARGVLPYVGNLITK,TWMSALGSVQLSTWLSTRSSSLLRTGKSTWQLGESYPMWATSSP

Amino Acids from 3' Exons

VRHWFRICHRQCRLCVSPGTTSIPMNFPILDP,SDTGSEFAIVSADCVVLEQHQYQISQYWIL,PTLVQNLPSSVQTVCESWNNINTNEFPNIGSW