McDonnell Genome Institute

Washington University

CircRNA

chr1|186347291|186350388|-|TPR|ENST00000367478.8

Cancer

Type of Peptide

OSCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9915

24

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

7

Peptide

EKQVQLLDTK

Amino Acids from 5' Exons

VSLATKKMWMILVSDRQKSRMTRRDSKQVRAMWNNIKQWLLVKNPTRKN,SAQQRRCGSCESAKTDRRAGELKGETQNKYEQCGTISSNGYFRRIPEQGKT,QPSNKEDVDDLVSQLRQTEEQVNDLKERLKTSTSNVEQYQAMVTSLEESLNKEKQ

Amino Acids from 3' Exons

VQLLDTKRQLDTETNLHLNTKELLKNAQKEIATLKQHLSNMEVQVASQSSQRTGK,FNFIQRDNWIQRQIFILTQKNYKMLKKKLPHNSTSVIWKSKLLLSLHRELVK,STFRYKETTGYRDKSSSHKRTIKKCSKRNCHIETAPQYGSPSCFSVFTENW