McDonnell Genome Institute

Washington University

CircRNA

chr1|186343905|186360905|-|TPR|ENST00000367478.8

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9494

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

6

Peptide

SQEQILEILSQQSNTR

Amino Acids from 5' Exons

DEVSKCVCRCEDLEKQNRLLHDQIEKLSDKVVASVKEGVQGPLNVSLSEEGKSQEQILEIL,MKFPNVYVAVKIWRNKTDYFMIRSKNVTRSLPLRKVYKVHMYLSVKKENLKNKFWKFS,SFQMCMSLRSGETKQITSSDRKIKQGRCLCEGRCTRSTECISQRRKISRTNFGNSQ

Amino Acids from 3' Exons

PTKQYKIIFRWSNPKIKWKKKCLRKGDWRRNRMQMTFFLPQNVK,QQSNTRSSSRGGAIQRSNGKRNAENREIGEGIRECKPSFCHKT,NKAIQDHLLEVEQSKDQMEKEMLEKIGRLEKELENANDLLSATKRK