McDonnell Genome Institute

Washington University

CircRNA

chr1|186174513|186174642|+|HMCN1|ENST00000271588.8

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9029

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

7

Peptide

ELEDPAWILMNVK

Amino Acids from 5' Exons

ILMNVKMGPISADITRYVRIQEAAIVVYAQEVIGLKELEDPAW,YMRWDPSVQIPDMEYKRQLSLCMPKRLSVSRSWKTLH,IDECKDGTHQCRYNQICENTRGSYRCVCPRGYRSQGVGRPCM

Amino Acids from 3' Exons

ILMNVKMGPISADITRYVRIQEAAIVVYAQEVIGLKELEDPAW,YMRWDPSVQIPDMEYKRQLSLCMPKRLSVSRSWKTLH,IDECKDGTHQCRYNQICENTRGSYRCVCPRGYRSQGVGRPCM