McDonnell Genome Institute

Washington University

CircRNA

chr1|185922378|185970493|+|HMCN1|ENST00000271588.8

Cancer

Type of Peptide

BRCA-Luminal B

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9932

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

6

Peptide

ITLDVGYLK

Amino Acids from 5' Exons

TSSSGRHSVRITGLSTIDFRAGFSRKPTLDFKKTVSRPVQ,PQAVEGTLFALLASVLLISELAFLESPPWTSKKQSADQCK,LKQWKALCSHYWPQYYFPSWLFSKAHPGLQKNSQQTSA

Amino Acids from 3' Exons

EILSGPQHSSLLTLSWDFRFKKHKIWMLAIIPVPSMRLEEQLARLWMLA,RSVEALNIPHYPSLGTFEDSRNTRSGCWRLYLCSHQGWKSNWQDNSGCW,DLELRPSTFLIIDPLLGLLKIQETQDLDAGDYTCVAINEAGRATGKITLDVG