McDonnell Genome Institute

Washington University

CircRNA

chr1|185139366|185140222|-|TRMT1L|ENST00000367506.9

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9362

9

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

8

Peptide

LQWQGIMGLQWAK

Amino Acids from 5' Exons

TSRPFWNISELSRFCIQKYKKPWHSVSDFYRYQFFICQGTACCPASLRMHCPNILQGTSSQNCCSCSGK,HLDPFGTSVNYLDSAFRNIRNLGIVSVTSTDISSLYAKAQHVARRHYGCNIVRTEYYKELAARIVVAAVA,ITLLEHQIIILHSEIETLACQLLQISVLYMPRHSMLPGVTTDVTLSELNITRNQPELLLQWQ

Amino Acids from 3' Exons

GWDYSGQNILEMQSKLQSMTMKILHFRKTAITNKWWWTVRKRKRVMIFLKKERKILVILRPKWMPMYCIDLLIS,DNGITVGKTSWKCSQSYNQLEKFCDTDSGKLPFKQIESGGGQGKGKEYSRRREKSWYGDQNGCQCTDAFEIFFH,IMGLQWAKHLGNAVKVTINDLNENSVTLIQENCHLNKLKVVVDSKEKEKSDDILEEGEKNLGNIKVTKMDANVLMHLRSFDF