McDonnell Genome Institute

Washington University

CircRNA

chr1|182859039|182872493|+|DHX9|ENST00000367549.3

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9756

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

9

Peptide

FMGGLTQFK

Amino Acids from 5' Exons

ATPEQISMDLKNELMYQLEQDHDLQA,LLQSKAWTSRMNCTSWNRIMICK,YSRANKHGPQEIDVPVGTGSFAS

Amino Acids from 3' Exons

TDFLLVVLRDVVQAYPEVRIVLMSATIDTSMFCEYFFNCPIIEVYGRTYPVQ,LTSFWYCVMLFRLILKFALFLCLLLLIPACFVNISSIAPSLKFMGGLTQFK,LPFGSTACCSGLSSSHCSYVCYYYQHVLIFLQLPHHSLWEDLPSS