McDonnell Genome Institute

Washington University

CircRNA

chr1|1790394|1793311|-|GNB1|ENST00000378609.8

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9359

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

9

Peptide

SSPALETPR

Amino Acids from 5' Exons

CPVGHRDRPADDHVYRTHWRCHEPFSCSHQTVRLWCLCFSQTLGCARRHVPADLHWPRVHQCHL,ALWDIETGQQTTTFTGHTGDVMSLSLAPDTRLFVSGACDASAKLWDVREGMCRQTFTGHESDINAIC,PCGTSRPASRRPRLPDTLEMSAFLLLLTPDCSSLVLVMLQPNSGMCEKACAGRPSLATSLTSMPF

Amino Acids from 3' Exons

VTCPAADSWMTIRSSPALETPR,LPVLLPIPGQSDRHQLWRHHV,YLSCCRFLDDNQIVTSSGDTT