McDonnell Genome Institute

Washington University

CircRNA

chr1|1789052|1839238|-|GNB1|ENST00000378609.8

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9996

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

22

2

Peptide

LLLAGYDDFNCNVWDALKADRADK

Amino Acids from 5' Exons

FFPNGNAFATGSDDATCRLFDLRADQELMTYSHDNIICGITSVSFSKSGRLLLAGYDDFNCNVWDALKADRA,SFQMAMHLPLAQTTPPAGCLTFVLTRSSLTPMTTSSAGSPLSPSPRAGASSLLGTTTSTATSGMHSKPTGQ,LSKWQCICHWLRRRHLQAVPSCPGAHDLLPQHHLRDHLCLLLQERAPPPCWVRRLQLQRLGCTQSRPG

Amino Acids from 3' Exons

TNLHVLETRPEALLN,QIYMYWRPDQKPFIK,KFTCIGDQTRSPSEL