McDonnell Genome Institute

Washington University

CircRNA

chr1|1789052|1793311|-|GNB1|ENST00000378609.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9597

34

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

6

Peptide

AGYLSCCR

Amino Acids from 5' Exons

FFPNGNAFATGSDDATCRLFDLRADQELMTYSHDNIICGITSVSFSKSGRLLLAGYDDFNCNVWDALKADRA,SFQMAMHLPLAQTTPPAGCLTFVLTRSSLTPMTTSSAGSPLSPSPRAGASSLLGTTTSTATSGMHSKPTGQ,LSKWQCICHWLRRRHLQAVPSCPGAHDLLPQHHLRDHLCLLLQERAPPPCWVRRLQLQRLGCTQSRPG

Amino Acids from 3' Exons

VTCPAADSWMTIRSSPALETPR,LPVLLPIPGQSDRHQLWRHHV,YLSCCRFLDDNQIVTSSGDTT