McDonnell Genome Institute

Washington University

CircRNA

chr1|178451570|178458544|+|RASAL2|ENST00000367649.7

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9154

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

5

Peptide

QQTQQGSLSK

Amino Acids from 5' Exons

GSLSKLCMSPMRTVKWIPANVHLVNTIRATKCAVSWLSARSSTLT,GVYQSFVVRELSGSQQMFITDRPSEQPENVLAGFLQDHQLLL,EFIKALYESDENCEVDPSKCSSSELIDHQSNLKMCCELAFCKIINSY

Amino Acids from 3' Exons

FATKISKPGQHRQLLQRENIIAGSASLLSEHDLFKGKGKPSWSERLPHGPPGHSCCSSGACICHACAYTLDRKPAFHNPGGQHQTAAGNPEHSPKCTPSEKAPAPSLEPARWPSALVVPEPCLSPQPNSSNAKGLYRFQFGEPKHCQFQKPKQRLQAQWTQQQHGRFHTHSEGLLQAAHGARTHTSCFATTKYWAGPDPKSGPGWVRCPSQSPTIPATQCFFTHREHVSGVRSPGGRTCAEWEPVPAAVLFLQREPCSQSSNPETTDTA,DLHKLKSPSQDNTDSYFRGKTLLLVQQASSQSMTYSEKDERESSLPNGRSVSLMDLQDTHAAQVEHASVMLDVPIRLTGSQLSITQVASIKQLRETQSTPQSAPQVRRPLHPALNQPGGLQPLSFQNPVYHLNNPIPAMPKASIDSSLENLSTASSRSQSNSEDFKLSGPSNSSMEDFTKRSTQSEDFSRRHTVPDRHIPLALPRQNSTGQAQIRKVDQGGLGARAKAPPSLPHSASLRSTGSMSVVSAALVAEPVQNGSRSRQQSSSSRESPVPKVRAIQRQQTQQ,ICINNLQARTTQTATSEGKHYCWFSKPPLRALILKRMKGKVAFLMVGASPSWTSRTLMLLKWSMHLSCLMCLYAPEASFPPRWPASNSCGKPRALPKVHPKEGPCTQPTSQVAFSPCRSRTLSITSITQFQQCQRPLIPVWRTALPVPEAKVTVKTSSSVDPAIAAWKISLNVALRVRTSPGGTRCQIDTYLLLCHDKIVLGRPRSEKWTRVGVPEPKPHHPCHTVLLYVAPGACQWCPQPWWPNLCRMGAGPGSSPLPPERALFPKLEQSRDNRHS