McDonnell Genome Institute

Washington University

CircRNA

chr1|178283563|178283691|+|RASAL2|ENST00000367649.7

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

9

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

14

Peptide

YCILTDSQLVLLNK

Amino Acids from 5' Exons

MKDHPPTVCLVVSHPTPRQQRGSGSIASSQTASWYCSTRRR,CERTTHPPSVLWSVTLHRDNNVGAEVLHPHRQPVGIAQQGEG,VKGPPTHRLSCGQSPYTETTTWERKYCILTDSQLVLLNKEKE

Amino Acids from 3' Exons

MKDHPPTVCLVVSHPTPRQQRGSGSIASSQTASWYCSTRRR,CERTTHPPSVLWSVTLHRDNNVGAEVLHPHRQPVGIAQQGEG,VKGPPTHRLSCGQSPYTETTTWERKYCILTDSQLVLLNKEKE