McDonnell Genome Institute

Washington University

CircRNA

chr1|174982833|174988838|+|RABGAP1L|ENST00000325589.9

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

3

Peptide

QQAASKEELEVVK

Amino Acids from 5' Exons

ICSQLSTRLEKQQAASKEELEVVK,SVRSVPGWRNSKQPARRSWKW,LFAVEYQAGETASSQQGGAGSGK

Amino Acids from 3' Exons

GKMMACKHCSDIFSKEGALKLAATGREDQGIETDDEKDSLKKQLREMELELAQTKLQLVEAKCKIQ,VRWHANTAVTFSARRVLNQPQAERTRELKQMMRRTHLRSSERWNWNWHKPNCSWWRPSVKF,DDGMQTLQHFQQGGCFETSSHRQRGPGNNREGLTEAAERDGTGTGTNQTAVGGGQVNS