McDonnell Genome Institute

Washington University

CircRNA

chr1|174969276|174988838|+|RABGAP1L|ENST00000325589.9

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9997

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

2

Peptide

RLQEASMR

Amino Acids from 5' Exons

RENRRLQEASMRLEQENDDLAHELVTSKIALRNDLDQ,GRTEDYRRPAGWNKRMMTLPMNQAKLLYGMTWI,GEPKITGGQHEVGTREPCPTSNKQNCSTELGS

Amino Acids from 3' Exons

GKMMACKHCSDIFSKEGALKLAATGREDQGIETDDEKDSLKKQLREMELELAQTKLQLVEAKCKIQ,VRWHANTAVTFSARRVLNQPQAERTRELKQMMRRTHLRSSERWNWNWHKPNCSWWRPSVKF,DDGMQTLQHFQQGGCFETSSHRQRGPGNNREGLTEAAERDGTGTGTNQTAVGGGQVNS