McDonnell Genome Institute

Washington University

CircRNA

chr1|174220971|174683596|+|RABGAP1L|ENST00000251507.8

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9923

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

3

Peptide

LLHIVSNGDEQLEK

Amino Acids from 5' Exons

IVSNGDEQLEKAMEEILRDSEKRPSSLLVDCQSSSEISDHSFGDIPASQTNKPSLQLILDPSNT,FLMVMNNWKKPWKRFEIPRKGQAVFLLIVKVPVRFQTIRLEIFQPAKQISHLFSFWIRLTQ,SFWTIGKSHGRDFERFREKAKQSSCLSKFQDFRPFVWRYSSQPNKAISSVNFGSVH

Amino Acids from 3' Exons

AYSVYDEDIGYCQGQSFLAAVLLLH,PTLCMMKTLGTVKGSLFLLLYYCC,LLCVRHWVLSRAVFSCCCITAA