McDonnell Genome Institute

Washington University

CircRNA

chr1|173964838|173965120|-|RC3H1|ENST00000258349.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9379

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

14

Peptide

IDHLSSSAPGSPPDLFRK

Amino Acids from 5' Exons

ISNEAPGSEKTLECLFGSTGGPAFSSYPSRRCSGSPQKTSCSAKWNCINREYSNTAYSARDRPQLFSETRKNRSSEQCSWIPSP,FRKMNKRLVPRRPLSASLGQLNEVGLPSAAILPDEGAVDLPSRKPPALPNGIVSTGNTVTQLIPRGTDPSYDSSLKPGKIDHLSSSAPGSPPD,FVKISAWFREDPVPLWVNLMRWACLQQLSFQMKVQWISLAENLLLCQMELYQQGIQHSLFREGQTPAMILVNQEKIIAVVLLDPLLT

Amino Acids from 3' Exons

ISNEAPGSEKTLECLFGSTGGPAFSSYPSRRCSGSPQKTSCSAKWNCINREYSNTAYSARDRPQLFSETRKNRSSEQCSWIPSP,FRKMNKRLVPRRPLSASLGQLNEVGLPSAAILPDEGAVDLPSRKPPALPNGIVSTGNTVTQLIPRGTDPSYDSSLKPGKIDHLSSSAPGSPPD,FVKISAWFREDPVPLWVNLMRWACLQQLSFQMKVQWISLAENLLLCQMELYQQGIQHSLFREGQTPAMILVNQEKIIAVVLLDPLLT