McDonnell Genome Institute

Washington University

CircRNA

chr1|173961076|173964187|-|RC3H1|ENST00000258349.8

Cancer

Type of Peptide

PRAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9815

16

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

4

Peptide

LHLHQPCLLPFIR

Amino Acids from 5' Exons

EPPYSRLPPPPQPHPSLDELHRRRKEIMAQLEERKVISPPPFAPSPTLPPTFHPEE,NLLIAGFLLLPSLILVMNYIADERKWPSRKERLSLHLLLHLHQPCLLPFIRK,TSLPASSSSPASSSRTTSPTKGNNGPARGKKGYLSTSFCTFTNLASYLSSGR

Amino Acids from 3' Exons

ARICSEYFCLTCESTFYTSKGASRSASNACYQTTSDGTSRFSVISSTTDGCLLSGSSRSSSAITSTLSA,LESVPKSISALPVNPHSIPPRGPADLPPMPVTKPLQMVPRGSQLYPAQQTDVYYQDPRGAAPPFEPAPYQQ,NLFLRVFLPYLIHILYLQGGQQICLQCLLPNHFRWYLEVLSYIQHNRRMFIIRILEEQLRHLNQHLISR