McDonnell Genome Institute

Washington University

CircRNA

chr1|173951985|173952138|-|RC3H1|ENST00000258349.8

Cancer

Type of Peptide

BRCA-Basal-like

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.997

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

11

Peptide

DVVAAGSVEMMFLDEDLK

Amino Acids from 5' Exons

FLDEDLKVAGKYKGNDYSQYSPWSCDTIGSYIGTKDAKPKDVVAAGSVEMM,FWMKTRLGNTKEMIIANTLPGHVTPSAPTLEPKMQNPKMLWQQGVWK,FGRLEGSWEIQRKLPILSLVMHHRLLHWNQRCKTQRCCGSRECGND

Amino Acids from 3' Exons

FLDEDLKVAGKYKGNDYSQYSPWSCDTIGSYIGTKDAKPKDVVAAGSVEMM,FWMKTRLGNTKEMIIANTLPGHVTPSAPTLEPKMQNPKMLWQQGVWK,FGRLEGSWEIQRKLPILSLVMHHRLLHWNQRCKTQRCCGSRECGND