McDonnell Genome Institute

Washington University

CircRNA

chr1|173946475|173952138|-|RC3H1|ENST00000258349.8

Cancer

Type of Peptide

BRCA-Basal-like

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9901

35

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

7

Peptide

GLEFLDEDLK

Amino Acids from 5' Exons

GENIYVRSGQSWKTPSICERTATTRIAAIEPSDPADPATWTR,ERISMSEVASHGKPLPSAEREQLRLELQQLNHQISQQTQLRGLE,REYLCQKWPVMENPFHLLRENSYDNCSNTIRLASRPSYVD

Amino Acids from 3' Exons

FLDEDLKVAGKYKGNDYSQYSPWSCDTIGSYIGTKDAKPKDVVAAGSVEMM,FWMKTRLGNTKEMIIANTLPGHVTPSAPTLEPKMQNPKMLWQQGVWK,FGRLEGSWEIQRKLPILSLVMHHRLLHWNQRCKTQRCCGSRECGND